ZFYVE19 Recombinant monoclonal antibody

• 

  WB analysis using 87425-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87425-2-RR (ZFYVE19 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87425-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87425-2-RR against Human ZFYVE19 were performed. The affinity constant is 0.345 nM.

ZFYVE19 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87425-2-RR

Clone No.252845F6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Abscission/NoCut checkpoint regulator, ANCHR, MPFYVE, Zinc finger FYVE domain-containing protein 19

---

Tested Applications

• Positive WB detected in: HeLa cells, Raji cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87425-2-RR targets ZFYVE19 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19593

  Product name: Recombinant human ZFYVE19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 123-471 aa of BC015738

  Sequence: VCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH

• Full Name: zinc finger, FYVE domain containing 19
• Calculated Molecular Weight: 471 aa, 52 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC015738
• Gene Symbol: ZFYVE19
• Gene ID (NCBI): 84936
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96K21
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFYVE19, also known as ANCHR, is a poorly characterized human protein. Recent clinical studies have linked biallelic loss-of-function mutations to a progressive familial intrahepatic cholestasis (PFIC) phenotype featuring neonatal-onset high-GGT cholestasis, congenital hepatic fibrosis, and sclerosing cholangiopathy. (PMID: 33853651)