ZHX3 Polyclonal antibody

• 

  WB analysis using 29397-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29397-1-AP (ZHX3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29397-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29397-1-AP (ZHX3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

ZHX3 Polyclonal Antibody for WB, ELISA

Cat No. 29397-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IF, ELISA

Synonyms

KIAA0395, TIX1, Triple homeobox protein 1, ZHX3, zinc fingers and homeoboxes 3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

29397-1-AP targets ZHX3 in WB, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30023

  Product name: Recombinant human ZHX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 848-956 aa of NM_015035

  Sequence: ELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLETD

• Full Name: zinc fingers and homeoboxes 3
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_015035
• Gene Symbol: ZHX3
• Gene ID (NCBI): 23051
• RRID: AB_2918292
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4I2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZHX3 is a member of the zinc fingers and homeoboxes (ZHX) gene family. ZHX3 is a ubiquitous transcriptional repressor expressed in human cells and tissues.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Am J Cancer Res; RNF26-mediated ubiquitination of TRIM21 promotes bladder cancer progression; Authors - Dongwei Yao