ZNF174 Monoclonal antibody, PBS Only

• 

  WB analysis using 68426-1-Ig (same clone as 68426-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68426-1-Ig (ZNF174 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68426-1-PBS in a different storage buffer formulation.

ZNF174 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68426-1-PBS

Clone No.2D9D3

Host / Isotype

Mouse / IgG3

Reactivity

Human, mouse, rat, rabbit

Applications

WB, Indirect ELISA

Synonyms

AW 1, zinc finger protein 174, ZNF174, ZSCAN8

---

Product Information

68426-1-PBS targets ZNF174 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples.

• Tested Reactivity: Human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12967

  Product name: Recombinant human ZNF174 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-234 aa of BC000876

  Sequence: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA

• Full Name: zinc finger protein 174
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC000876
• Gene Symbol: ZNF174
• Gene ID (NCBI): 7727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15697
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.