ZNF217 Polyclonal antibody, PBS Only

• 

  WB analysis using 24869-1-AP (same clone as 24869-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24869-1-AP (ZNF217 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24869-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NCCIT using 24869-1-AP (same clone as 24869-1-PBS)

  IP result of anti-ZNF217 (IP:24869-1-AP, 4ug; Detection:24869-1-AP 1:300) with NCCIT cell lysate 3200ug. This data was developed using the same antibody clone with 24869-1-PBS in a different storage buffer formulation.

ZNF217 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24869-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

24869-1-PBS targets ZNF217 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19468

  Product name: Recombinant human ZNF217 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 707-1043 aa of BC113427

  Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP

• Full Name: zinc finger protein 217
• Calculated Molecular Weight: 1048 aa, 115 kDa
• Observed Molecular Weight: ~130 kDa
• GenBank Accession Number: BC113427
• Gene Symbol: ZNF217
• Gene ID (NCBI): 7764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75362
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.