ZNF551 Polyclonal antibody

• 

  WB analysis using 33216-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33216-1-AP (ZNF551 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 33216-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33216-1-AP (ZNF551 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZNF551 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33216-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

KOX23, Zinc finger protein 551, Zinc finger protein KOX23

---

Tested Applications

• Positive WB detected in: DU 145 cells, HEK-293 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33216-1-AP targets ZNF551 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35151

  Product name: Recombinant human ZNF551 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-293 aa of BC005868

  Sequence: QVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAAEHQTTSPVQKSYLGSTSMRGFCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFNAKSYYKWGEYRKASSHKHTLVQHQSVCSEGGLYECSKCEKAFTCKNTLVQHQQIHTGQKMFECSECEESFSKKCHLILHKIIHTGERPYEC

• Full Name: zinc finger protein 551
• Calculated Molecular Weight: 670 aa, 78 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC005868
• Gene Symbol: ZNF551
• Gene ID (NCBI): 90233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z340
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.