ZNF589 Polyclonal antibody

ZNF589 Polyclonal Antibody for IP, ELISA
Cat No. 33033-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, ELISA

Stem cell zinc finger protein 1, SZF1, Zinc finger protein 589

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IP detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

33033-1-AP targets ZNF589 in IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36351

Product name: Recombinant human ZNF589 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 76-250 aa of BC166625

Sequence: ESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVC

Predict reactive species
Full Name zinc finger protein 589
Observed Molecular Weight47 kDa
GenBank Accession NumberBC166625
Gene Symbol ZNF589
Gene ID (NCBI) 51385
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ86UQ0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF589(Zinc Finger Protein 589) is a protein coding gene located at 19q13.43 in human genome, belonging to C2H2 zinc finger protein family. Most members of this family appear in the form of "KRAB-ZNF", that is, the N-terminal has a KRAB(Krüppel-associated box) transcription inhibitory domain, and the C-terminal is a DNA binding domain composed of multiple C2H2 zinc fingers connected in series. ZNF589 also follows this classic structure: KRAB-A/B box at N end, middle linker, and 11 continuous C2H2 zinc fingers at C end. Because KRAB domain can recruit KAP1/TRIM28 and other co-inhibitory complexes, ZNF589 is generally regarded as a potential transcription inhibitor. GTEx data showed that the expression of ZNF589 was low to moderate in almost all adult tissues, with the highest expression in testis, ovary, thyroid, spleen, peripheral blood leukocytes and embryonic stem cells (hESC).

Protocols

Product Specific Protocols
IP protocol for ZNF589 antibody 33033-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...