Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, Jurkat cells, U-251 cells, RT-4 cells, NIH/3T3 cells |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
31934-1-AP targets ZNF787 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36052 Product name: Recombinant human ZNF787 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC077728 Sequence: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQS Predict reactive species |
| Full Name | zinc finger protein 787 |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC077728 |
| Gene Symbol | ZNF787 |
| Gene ID (NCBI) | 126208 |
| RRID | AB_3670151 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6DD87 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Zinc finger protein 787 (ZNF787, also known as TIP20) is activated in the nucleus and may be involved in transcriptional regulation. It probably is one repressor of neuronal features and can interact with histone deacetylase 1 (HDAC1) in regulating the permeability of the blood-brain barrier (BBB) as well as the pathogenesis of Alzheimer's disease (PMID: 33057419; 38329647).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZNF787 antibody 31934-1-AP | Download protocol |
| WB protocol for ZNF787 antibody 31934-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



