ZNF816 Polyclonal antibody

• 

  IHC staining of human ovary tumor using 21221-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21221-1-AP (ZNF816A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 21221-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21221-1-AP (ZNF816A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 21221-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using ZNF816A antibody (21221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of U-251 using 21221-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using ZNF816A antibody (21221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ZNF816 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 21221-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

ZNF816A

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21221-1-AP targets ZNF816 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15658

  Product name: Recombinant human ZNF816A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 399-506 aa of BC105930

  Sequence: CEECDNVYIRRSHLERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTCNECGKVFSRRENLARHHRLHAGE

• Full Name: zinc finger protein 816A
• Calculated Molecular Weight: 651 aa, 76 kDa
• GenBank Accession Number: BC105930
• Gene Symbol: ZNF816A
• Gene ID (NCBI): 125893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q0VGE8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF816 ( Zinc finger protein 816), a direct target of ZBED4, was found to interact with multiple FDA-approved immunomodulatory agents, suggesting a potential ZBED4-ZNF816 regulatory axis with translational value.