ZNF821 Polyclonal antibody

• 

  WB analysis using 33351-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33351-1-AP (ZNF821 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 33351-1-AP

  WB result of ZNF821 antibody (33351-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF821 transfected LNCaP cells.

• Featured Product
• KD/KO Validated

ZNF821 Polyclonal Antibody for WB, ELISA

Cat No. 33351-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Zinc finger protein 821

---

Tested Applications

• Positive WB detected in: LNCaP cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33351-1-AP targets ZNF821 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38977

  Product name: Recombinant human ZNF821 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-370 aa of BC012116

  Sequence: AAYRKLLEAQTPSVRKWALRRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRDREAKRLQRMQETDEQRARRLQRDREAMRLKRANETPEKRQARLIREREAKRLKRRLEKMDMMLRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH

• Full Name: zinc finger protein 821
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC012116
• Gene Symbol: ZNF821
• Gene ID (NCBI): 55565
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75541
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.