ZRSR2 Polyclonal antibody

• 

  WB analysis using 33753-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33753-1-AP (ZRSR2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

ZRSR2 Polyclonal Antibody for WB, ELISA

Cat No. 33753-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2, U2AF1L2, U2AF1RS2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33753-1-AP targets ZRSR2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36984

  Product name: Recombinant human ZRSR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-482 aa of BC050451

  Sequence: NSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSCRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK

• Full Name: zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC050451
• Gene Symbol: ZRSR2
• Gene ID (NCBI): 8233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q15696
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.