ZSCAN1 Polyclonal antibody

• 

  WB analysis using 32583-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32583-1-AP (ZSCAN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ZSCAN1 Polyclonal Antibody for WB, ELISA

Cat No. 32583-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Zinc finger and SCAN domain-containing protein 1

---

Tested Applications

• Positive WB detected in: rat testis tissue, mouse testis tissue, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32583-1-AP targets ZSCAN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37955

  Product name: Recombinant human ZSCAN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 261-400 aa of NM_182572

  Sequence: HQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQK

• Full Name: zinc finger and SCAN domain containing 1
• Calculated Molecular Weight: 408 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_182572
• Gene Symbol: ZSCAN1
• Gene ID (NCBI): 284312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NBB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZSCAN1 is a transcription factor containing a zinc finger domain and a SCAN domain. ZSCAN1 has been implicated in diverse biological processes. It has been shown to act as a stemness-related tumor suppressor and transcriptional repressor in breast cancer, targeting TAZ to influence cancer progression. Additionally, ZSCAN1 is involved in early embryonic development, where it helps regulate the expression of genes necessary for proper embryogenesis. It also plays a role in the immune response, with anti-ZSCAN1 autoantibodies being identified as potential diagnostic markers for certain syndromes like ROHHAD (PMID: 38339072). According to Human Protein Atlas database, ZSCAN1 is mainly expressed in brain, pituitary gland and testis tissue.