Zyxin Polyclonal antibody

• 

  WB analysis using 10330-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10330-1-AP (Zyxin antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10330-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10330-1-AP (Zyxin antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 10330-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10330-1-AP (Zyxin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 10330-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using Zyxin antibody (10330-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

Zyxin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10330-1-AP

Publications(8)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ZYX, Zyxin-2

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells, DU 145 cells, MDA-MB-231 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

10330-1-AP targets Zyxin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0419

  Product name: Recombinant human ZYX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 278-572 aa of BC008743

  Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

• Full Name: zyxin
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC008743
• Gene Symbol: Zyxin
• Gene ID (NCBI): 7791
• RRID: AB_2221279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15942
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin (ZYX) is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Cell Biol; The late endosomal p14-MP1 (LAMTOR2/3) complex regulates focal adhesion dynamics during cell migration.; Authors - Natalia Schiefermeier
mouse,human	WB,IF	Cell Death Dis; Essential role of zyxin in platelet biogenesis and glycoprotein Ib-IX surface expression; Authors - Rong Yan ; KD Validated
rabbit	IF	Cell Prolif; Zyxin-involved actin regulation is essential in the maintenance of vinculin focal adhesion and chondrocyte differentiation status.; Authors - Gaoming Li ; KD Validated
human	WB,IP,IF	J Biol Chem; O-GlcNAc transferase promotes the nuclear localization of the focal adhesion-associated protein Zyxin to regulate UV-induced cell death.; Authors - Yuhang Zhao
mouse	WB	Am J Physiol Gastrointest Liver Physiol; Targeted disruption of the Lasp-1 gene is linked to increases in histamine-stimulated gastric HCl secretion.; Authors - Chew Catherine S CS
mouse	WB,IF	Physiol Genomics; Lasp1 gene disruption is linked to enhanced cell migration and tumor formation.; Authors - Zhang Han H

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alex (Verified Customer) (08-20-2025)

Excellent staining of adhesions and actin filament tips. Consistent with literature-reported fluorescent protein constructs. In image: A - Paxillin (from another manufacturer) B - Zyxin (10330-1-AP. 1:200) C - Phalloidin (from another manufacturer) D - Merged (G = Paxillin; R = Zyxin; gray = phalloidin)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: neural

Zyxin Antibody Immunofluorescence validation (1:200 dilution) in neural (Cat no:10330-1-AP)