Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, MCF-7 cells, DU 145 cells, MDA-MB-231 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10330-1-AP targets Zyxin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0419 Product name: Recombinant human ZYX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 278-572 aa of BC008743 Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT Predict reactive species |
| Full Name | zyxin |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 78 kDa |
| GenBank Accession Number | BC008743 |
| Gene Symbol | Zyxin |
| Gene ID (NCBI) | 7791 |
| RRID | AB_2221279 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15942 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin (ZYX) is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Zyxin antibody 10330-1-AP | Download protocol |
| IHC protocol for Zyxin antibody 10330-1-AP | Download protocol |
| WB protocol for Zyxin antibody 10330-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Zyxin (Lasp-1) antibody, catalog number 10330-1-AP, has 11 citations published in journals including Cell Death & Disease, J Cell Biol, J Biol Chem, JCI Insight, Cancer Cell Int, Biomedicines, Cell Proliferation, Am J Physiol Gastrointest Liver Physiol, Physiol Genomics, and bioRxiv. Research fields span platelet biogenesis, focal adhesion dynamics, chondrocyte differentiation, hepatocellular carcinoma, osteosarcoma, gastric secretion, tumor migration, UV-induced cell death, and nuclear mechanical stress protection.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Essential role of zyxin in platelet biogenesis and glycoprotein Ib-IX surface expression
| ||
Cell Prolif Zyxin-involved actin regulation is essential in the maintenance of vinculin focal adhesion and chondrocyte differentiation status.
| ||
Cancer Cell Int Does rAj-Tspin, a novel peptide from A. japonicus, exert antihepatocellular carcinoma effects via the ITGB1/ZYX/FAK/AKT signaling pathway | ||
JCI Insight Altered chaperone-nonmuscle myosin II interactions drive pathogenicity of the UNC45A c.710T>C variant in osteo-oto-hepato-enteric syndrome | ||
J Cell Biol The late endosomal p14-MP1 (LAMTOR2/3) complex regulates focal adhesion dynamics during cell migration. | ||
Biomedicines Zyxin Inhibits the Proliferation, Migration, and Invasion of Osteosarcoma via Rap1-Mediated Inhibition of the MEK/ERK Signaling Pathway |
Reviews
What customers say
The single review reports excellent immunofluorescence staining of adhesions and actin filament tips at a 1:200 dilution in neural tissue, consistent with literature-reported fluorescent protein constructs. The reviewer compared it alongside Paxillin and Phalloidin from other manufacturers, noting clear Zyxin signal in the merged image. Overall, the product received a 5-star rating, reflecting strong performance and reliable staining quality.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alex (Verified Customer) (08-20-2025) | Excellent staining of adhesions and actin filament tips. Consistent with literature-reported fluorescent protein constructs. In image: A - Paxillin (from another manufacturer) B - Zyxin (10330-1-AP. 1:200) C - Phalloidin (from another manufacturer) D - Merged (G = Paxillin; R = Zyxin; gray = phalloidin)
 |
