GFP tag Polyclonal antibody

GFP tag Polyclonal Antibody for WB, IF/ICC, IF-P, IP, ELISA
Cat No. 50430-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

aequorea victoria, recombinant protein and More (7)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA

eGFP, GFP, CFP, eYFP, GFP-tag

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrecombinant protein, Transfected HEK-293 cells
Positive IP detected inTransfected HEK-293T cells
Positive IF-P detected intransgenic mouse brain tissue
Positive IF/ICC detected inTransfected HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

50430-2-AP targets GFP tag in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA applications and shows reactivity with aequorea victoria, recombinant protein samples.

Tested Reactivity aequorea victoria, recombinant protein
Cited Reactivitymouse, rat, pig, canine, yeast, escherichia coli, silkworm
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2128

Product name: Recombinant aequorea victoria GFP tag protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of M62653

Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Predict reactive species
Full Name GFP tag
Calculated Molecular Weight 26 kDa
GenBank Accession NumberM62653
Gene Symbol
Gene ID (NCBI)
RRIDAB_11042881
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42212
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages. 

Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.

When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a rabbit polyclonal antibody, generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP.


Protocols

Product Specific Protocols
IF protocol for GFP tag antibody 50430-2-APDownload protocol
IP protocol for GFP tag antibody 50430-2-APDownload protocol
WB protocol for GFP tag antibody 50430-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nat Biotechnol

Programmable protein expression using a genetically encoded m6A sensor

Authors - Bahjat F Marayati
WB

Signal Transduct Target Ther

Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis

Authors - Chuan Yang
WB

Cell

Phase separation drives RNA virus-induced activation of the NLRP6 inflammasome.

Authors - Chen Shen
WB,IF

Gastroenterology

PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis

Authors - Tian-Yi Jiang
WB

Nat Genet

Pathogenic SPTBN1 variants cause an autosomal dominant neurodevelopmental syndrome.

Authors - Margot A Cousin
WB,CoIP

Mol Plant

A TT1-SCE1 module integrates ubiquitination and SUMOylation to regulate heat tolerance in rice

Authors - Hong-Xiao Yu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Manon (Verified Customer) (09-25-2025)

It works well

  • Applications: Western Blot
  • Cell Tissue Type: Fibroblasts
FH

Ioana (Verified Customer) (08-27-2025)

I have used this antibody for a lot of different applications and it has performed well throughout. I was particularly impressed with it's efficiency in doing IP experiments.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: HeLaM, NRK
FH

Yi (Verified Customer) (07-23-2025)

This GFP antibody performs reliably in both Western blot and co-IP applications. It shows strong specificity and sensitivity for GFP-tagged proteins, with clean results and minimal background for detecting and pulling down GFP fusion proteins.

  • Applications: Immunoprecipitation
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: human
FH

Kamal (Verified Customer) (02-27-2025)

Liver lysates were subjected to SDS-PAGE and immunoblotted with GFP antibody. Multiple non-specific protein bands were detected in liver tissue lysates.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Liver tissue
GFP tag Antibody Western Blot validation (1:2000 dilution) in Liver tissue (Cat no:50430-2-AP)
FH

Raquel (Verified Customer) (07-12-2024)

Immunofluorescence analysis in cryostat sections of 4% PFA fixed human brain organoid derived from iPSCs expressing YFP with 50430-2-AP GFP tag antibody at dilution of 1:100 (under 20x lens). (Green:YFP; Magenta: GFP tag antibody)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human brain organoids
GFP tag Antibody Immunofluorescence validation (1:100 dilution) in Human brain organoids (Cat no:50430-2-AP)
FH

S (Verified Customer) (05-26-2023)

Excellent

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 500
  • Cell Tissue Type: AC16
GFP tag Antibody Western Blot,Immunofluorescence validation (500 dilution) in AC16 (Cat no:50430-2-AP)
FH

PK (Verified Customer) (03-20-2023)

Very Good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: HEK
GFP tag Antibody Western Blot validation (1000 dilution) in HEK (Cat no:50430-2-AP)
FH

Stephen (Verified Customer) (08-02-2022)

HeLa cells transfected with plasmid expressing EGFP fixed with 4% PFA for 15 mins and immunostained with rabbit GFP antibody at 4 degrees incubated for 20h washed then incubated secondary alexa 594 and DAPI for 1 hour room temp imaged on wide field fluorescence microscope.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa
GFP tag Antibody Immunofluorescence validation (1:1000 dilution) in HeLa (Cat no:50430-2-AP)
FH

A (Verified Customer) (01-04-2022)

Works for IP

  • Applications: Immunoprecipitation
  • Cell Tissue Type: C. elegans
FH

Rinalda (Verified Customer) (06-21-2021)

Great product

  • Applications: Western Blot
  • Cell Tissue Type: fungal cells
FH

Lana (Verified Customer) (12-22-2020)

SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) for 2h at 80V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:2500.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 – HEK293 whole cell lysate, negative transfection, 3 – whole cell lysate of cells transfected with eGFP.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: HEK293
GFP tag Antibody Western Blot validation (1:2500 dilution) in HEK293 (Cat no:50430-2-AP)
FH

Paul (Verified Customer) (01-15-2020)

Works well for WB.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
FH

Laura (Verified Customer) (01-14-2020)

Good sensitivity for Western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
FH

Aamir (Verified Customer) (01-08-2020)

Works well for WB and IF

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: HEKs
FH

Erica (Verified Customer) (09-26-2019)

This antibody works very well with both western blots and IP. We previously used GFP antibody from another company and it didn't work well. We then switched to Proteinntech's and the signal was very strong! Highly recommend!

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:2000 WB
  • Cell Tissue Type: HEK, MEF, HELA
FH

Mayur (Verified Customer) (04-30-2019)

The H4 cells were transfected with pcDNA only and pcDNA EGFP . The expression of the EGFP was measured using the GFP antibody from ProteinTech. Great antibody.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:5K
  • Cell Tissue Type: H4 cells
GFP tag Antibody Western Blot, validation (1:5K dilution) in H4 cells (Cat no:50430-2-AP)
Loading...
||
New chat Able
正在加载,请稍候...