CoraLite® Plus 488-conjugated GFP tag Polyclonal antibody

GFP tag Polyclonal Antibody for IF-P
Cat No. CL488-50430

Host / Isotype

Rabbit / IgG

Reactivity

aequorea victoria, recombinant protein

Applications

IF-P

eGFP, GFP, green, GFP-tag, eYFP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-50430 targets GFP tag in IF-P applications and shows reactivity with aequorea victoria, recombinant protein samples.

Tested Reactivity aequorea victoria, recombinant protein
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2128

Product name: Recombinant aequorea victoria GFP tag protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of M62653

Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Predict reactive species
Full Name GFP tag
Calculated Molecular Weight 26 kDa
GenBank Accession NumberM62653
Gene Symbol
Gene ID (NCBI)
RRIDAB_3672849
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42212
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages. 

Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.

When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a rabbit polyclonal antibody, generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP.

This antibody is labeled with CoraLite Plus 488.


Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GFP tag antibody CL488-50430Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...