GFP tag Monoclonal antibody

GFP tag Monoclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 66002-1-Ig
Clone No.1E10H7

Host / Isotype

Mouse / IgG2a

Reactivity

recombinant protein and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

eGFP, GFP, CFP, eYFP, GFP-tag

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inGFP transgenic mouse brain tissue, Recombinant protein
Positive IP detected inTransfected HEK-293T cells
Positive IF/ICC detected inTransfected HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66002-1-Ig targets GFP tag in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2128

Product name: Recombinant aequorea victoria GFP tag protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of M62653

Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Predict reactive species
Full Name GFP tag
Calculated Molecular Weight 26 kDa
GenBank Accession NumberM62653
Gene Symbol
Gene ID (NCBI)
RRIDAB_11182611
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42212
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages. 

Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.

When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a mouse (IgG2a) monoclonal antibody against GFP reactive to GFP, eGFP, eYFP, YFP and CFP.


Protocols

Product Specific Protocols
IF protocol for GFP tag antibody 66002-1-IgDownload protocol
IP protocol for GFP tag antibody 66002-1-IgDownload protocol
WB protocol for GFP tag antibody 66002-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB,IP

Cell

The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins

Authors - Huaqing Deng

Nature

The CoQ oxidoreductase FSP1 acts parallel to GPX4 to inhibit ferroptosis.

Authors - Kirill Bersuker
WB,IF

Cell Discov

Glc7/PP1 dephosphorylates histone H3T11 to regulate autophagy and telomere silencing in response to nutrient availability

Authors - Xinyu Zhang

Cell Host Microbe

Microbiota-derived urocanic acid triggered bytyrosine kinase inhibitors potentiates cancer immunotherapy efficacy

Authors - Mengying Zhang
WB,CoIP

Cell Metab

Protein O-GlcNAcylation and hexokinase mitochondrial dissociation drive heart failure with preserved ejection fraction

Authors - Yuki Tatekoshi
WB

Nat Genet

Pathogenic SPTBN1 variants cause an autosomal dominant neurodevelopmental syndrome.

Authors - Margot A Cousin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Javier (Verified Customer) (09-09-2025)

Perfect antibody for Wb and IP assays.

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mice kidneys
FH

Ioana (Verified Customer) (08-27-2025)

This antibody works well in Western Blotting and amplifying signal after PFA fixation during IF.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: HeLaM, NRK
FH

Anastasia (Verified Customer) (08-07-2024)

Zebrafish embryos expressing cytosolic GFP

  • Applications: Western Blot
  • Cell Tissue Type: Zebrafish embryos
GFP tag Antibody Western Blot validation ( dilution) in Zebrafish embryos (Cat no:66002-1-Ig)
FH

Amy (Verified Customer) (02-11-2023)

Detected EGFP-tagged constructs expressed in HEK293T cells at similar strength to other antibodies however with slightly more background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:20,000
  • Cell Tissue Type: HEK293T
GFP tag Antibody Western Blot validation (1:20,000 dilution) in HEK293T (Cat no:66002-1-Ig)
FH

Tom (Verified Customer) (02-03-2023)

Works great. No problem. Love proteintech.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:25000
  • Cell Tissue Type: Bacteria
FH

Tatyana (Verified Customer) (01-09-2023)

Good signal, antibody can be reused. Overexpressed GFP-tagged proteins (and GFP alone) were pulled down using GFP-Trap beads and WB was done on lysates and IP samples. Antibody was diluted in 4% milk (and could be reused several times).

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Human / HeLa cells
GFP tag Antibody Western Blot,Immunoprecipitation validation (1:2000 dilution) in Human / HeLa cells (Cat no:66002-1-Ig)
FH

Sheila (Verified Customer) (07-22-2022)

It works very well

  • Applications: Western Blot, Immunoprecipitation
  • Cell Tissue Type: Murine Breast cancer
FH

Juliana (Verified Customer) (01-28-2022)

works great for Western blot!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: HEK293T
FH

Prasanna (Verified Customer) (01-04-2021)

Of the 3 antibodies tested for GFP this one gave the cleanest and strongest signal by western blot. When I saw it on sale, I bought 8!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: Hap1, N2a (mouse neuroblastoma)
FH

Lana (Verified Customer) (12-22-2020)

SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) for 2h at 80V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:5000.Secondary Ab: IRDye 800CW Goat anti-Mouse, 1:15000.Lines of WB image: 1 – protein ladder, 2 – HEK293 whole cell lysate, negative transfection, 3 – whole cell lysate of cells transfected with eGFP.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK293
GFP tag Antibody Western Blot validation (1:5000 dilution) in HEK293 (Cat no:66002-1-Ig)
FH

Thomas (Verified Customer) (11-19-2020)

HEK293T and HEK293T stably transfected with pAcGFP plasmid. 10ug total protein loaded per well. Membrane blocked 1 hour in 5% BSA prior to anti-GFP (1:2000) o/n at 4 degrees. Goat anti-mouse HRP secondary (1:10,000) used.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T
GFP tag Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:66002-1-Ig)
FH

Jane (Verified Customer) (03-02-2020)

Adenovirus-GFP infected cardiomyocytes stained with GFP antibody, signal is strong and effective

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: cardiomyocyte culture
FH

LUNFENG (Verified Customer) (01-27-2020)

GOOD

  • Applications: Immunofluorescence,
  • Cell Tissue Type: HEART
FH

Jie (Verified Customer) (01-27-2020)

Worked for western blot with GFP-LC3 transfected cardiomyocytes

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: cardiomyocytes
FH

Paul (Verified Customer) (01-15-2020)

Works well for Westerns.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: HEK293T
FH

Laura (Verified Customer) (01-15-2020)

Good antibody for Western Blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK293T
FH

Aamir (Verified Customer) (01-08-2020)

Worked well for WB

  • Applications: Western Blot,
  • Primary Antibody Dilution: 5000
  • Cell Tissue Type: HEKs
FH

Benjamin (Verified Customer) (01-07-2020)

Easily detects recombinant GFP protein via western blot with very little background.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2500 to 1:5000
  • Cell Tissue Type: Recombinant GFP protein
FH

Jing (Verified Customer) (01-03-2020)

Used this to detect tranduce efficiency of the AAV-GFP virus. with 5% non-fat milk, there are two bands around 20-30kd, not sure which one is correct. And the antibody is relative weak, has to use 1:500 dilution.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: mouse heart
FH

Shan (Verified Customer) (12-25-2019)

The GFP antibody showed great sensitivity for WB and it was easily detecable. But it was insteresting that when the SDS PAGE gel separating gel concentration reeached to 12%, you can see two bands at ~30kDa and ~20kDa.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: 293T
GFP tag Antibody Western Blot, validation (1:2500 dilution) in 293T (Cat no:66002-1-Ig)
FH

Jason (Verified Customer) (11-04-2019)

This is a good antibody for detecting GFP tag on Western blot, using 1:1000 dilution. The price is unbeatable, worth each penny.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: GFP-tagged protein expressed in human cell lines
FH

Hend (Verified Customer) (10-14-2019)

antibody used in western blot against egfp labelled protien and clear band was detected.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1 to 4000
Loading...
||
New chat Able
正在加载,请稍候...