hCG Beta Polyclonal antibody, PBS Only

• 

  WB analysis using 11615-1-AP (same clone as 11615-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11615-1-AP (hCG Beta antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11615-1-AP (same clone as 11615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11615-1-AP (hCG beta antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11615-1-AP (same clone as 11615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11615-1-AP (hCG beta antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11615-1-AP (same clone as 11615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11615-1-AP (hCG beta antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11615-1-AP (same clone as 11615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11615-1-AP (hCG beta antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11615-1-AP (same clone as 11615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11615-1-AP (hCG beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11615-1-AP (same clone as 11615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11615-1-AP (hCG beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11615-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

hCG Beta Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11615-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CGB, CGB,hCG, CG beta, CGB3, CGbeta

---

Product Information

11615-1-PBS targets hCG Beta in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2191

  Product name: Recombinant human CGB,hCG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC022796

  Sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

• Full Name: CG beta
• Calculated Molecular Weight: 165 aa, 18 kDa
• GenBank Accession Number: BC022796
• Gene Symbol: hCG Beta
• Gene ID (NCBI): 1082
• RRID: AB_2877783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DN86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta.