Tested Applications
| Positive WB detected in | pig spleen tissue, pig tonsil tissue |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31495-1-AP targets human IgG3 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35740 Product name: Recombinant human IGHG3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 239-312 aa of NG_001019.6 Sequence: LHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE Predict reactive species |
| Full Name | immunoglobulin heavy constant gamma 3 (G3m marker) |
| Calculated Molecular Weight | 49kDa,446aa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | NG_001019.6 |
| Gene Symbol | IGHG3 |
| Gene ID (NCBI) | 3502 |
| RRID | AB_3670007 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P01860 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for human IgG3 antibody 31495-1-AP | Download protocol |
| WB protocol for human IgG3 antibody 31495-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





