Tested Applications
Positive WB detected in | Recombinant protein |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28209-1-AP targets mAID tag in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27843 Product name: Recombinant arabidopsis thaliana mAID tag protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: KEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYK Predict reactive species |
Full Name | mAID tag |
Calculated Molecular Weight | 8 kDa |
Gene Symbol | |
Gene ID (NCBI) | |
RRID | AB_2881090 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
This antibody detect the miniAID tag.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for mAID tag antibody 28209-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |