mAID tag Polyclonal antibody

• Home
• Products
• Primary Antibodies
• mAID tag Polyclonal antibody (28209-1-AP)

mAID tag Polyclonal Antibody for WB, ELISA

Cat No. 28209-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, ELISA

Synonyms

• 

  WB analysis of transfected HEK-293T using 28209-1-AP

  Non-transfected or mAID-tagged EGFP-transfected HEK-293T cells were subjected to SDS PAGE followed by western blot with 28209-1-AP (mAID tag antibody) at a dilution of 1:10000, incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Recombinant protein using 28209-1-AP

  mAID tagged recombinant protein were subjected to SDS PAGE followed by western blot with 28209-1-AP (mAID tag antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for mAID tag in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Recombinant protein, transfected HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28209-1-AP targets mAID tag in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27843

  Product name: Recombinant arabidopsis thaliana mAID tag protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of

  Sequence: KEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYK

• Full Name: mAID tag
• Calculated Molecular Weight: 8 kDa
• RRID: AB_2881090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detect the miniAID tag.

Publications

What published studies show

The mAID tag Polyclonal antibody (Cat# 28209-1-AP) has 2 citations. These appear in Nature Communications and bioRxiv. The cited research covers mechanosensor-mediated Hsp70 phosphorylation in the heat shock response (WB) and loop extrusion accelerating long-range enhancer-promoter interactions in living embryos (IF).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; Mechanosensor-mediated Hsp70 phosphorylation orchestrates the landscape of the heat shock response.; Authors - Siddhi Omkar
	IF	bioRxiv; Loop Extrusion Accelerates Long-Range Enhancer-Promoter Searches in Living Embryos.; Authors - Pavan Choppakatla