Tested Applications
Positive WB detected in | Transfected HEK-293 cells, Recombinant protein |
Positive IP detected in | Transfected HEK-293T cells |
Positive IF/ICC detected in | Transfected HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 65 publications below |
IHC | See 4 publications below |
IF | See 38 publications below |
IP | See 10 publications below |
CoIP | See 4 publications below |
Product Information
26765-1-AP targets mCherry in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples.
Tested Reactivity | recombinant protein |
Cited Reactivity | human, mouse, rabbit, zebrafish, yeast, d. punctatus, plant |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species |
Full Name | mCherry |
Calculated Molecular Weight | 27 kDa |
Gene Symbol | |
Gene ID (NCBI) | |
RRID | AB_2876881 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.
The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm).
When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.
This antibody is a rabbit polyclonal antibody raised against mCherry. It can be used to detect mCherry, dsRed, tdTomato, and mScarlet.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for mCherry antibody 26765-1-AP | Download protocol |
IF protocol for mCherry antibody 26765-1-AP | Download protocol |
IP protocol for mCherry antibody 26765-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Struct Mol Biol Aurora kinase A-mediated phosphorylation triggers structural alteration of Rab1A to enhance ER complexity during mitosis | ||
Nat Commun Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis | ||
J Extracell Vesicles Identification of the SNARE complex that mediates the fusion of multivesicular bodies with the plasma membrane in exosome secretion | ||
Cell Death Differ RING1 dictates GSDMD-mediated inflammatory response and host susceptibility to pathogen infection |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Alexandra (Verified Customer) (07-02-2024) | Not the strongest antibody I've ever used but it works fine, the maximum recomended dilution is 1000x, but possibly 500x would be more effective.
![]() |
FH Verdiana (Verified Customer) (10-12-2023) | Nice and clear bands!
|
FH Andrea (Verified Customer) (10-05-2023) | Good and strong signal for the mCherry fusion protein. In my case it was a 1:1000 dilution.
![]() |
FH Tatyana (Verified Customer) (01-09-2023) | Excellent antibody, very good bright signal, no background or non-specific bands. HeLa cells were transfected with plasmids for expression of mCherry tagged proteins, lysed after 24 hours, followed by WB (semi-dry transfer, blocking in 4% milk). Antibody was diluted in 4% milk.
![]() |
FH Laura (Verified Customer) (01-14-2020) | Antibody was used in 5% TBST overnight, gave a clean blot.
|
FH Benjamin (Verified Customer) (12-10-2019) | This antibody has been used to image mCherry fusion proteins expressed in HEK293T cells via western blot with high rates of success.Antibody was diluted in 3% milk TBST and incubated overnight at 4 degrees.
|
FH Liang (Verified Customer) (05-27-2019) | The antibody works perfect. According the attached image, The 2nd from the left is the negative control protein (mGFP) and the 3rd lane is the mCherry protein as the positive control, the others are the target protein.
![]() |