p38 MAPK Monoclonal antibody

• 

  WB analysis using 66234-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66234-1-Ig

  WB result of p38 MAPK antibody (66234-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-p38 MAPK transfected HEK-293 cells.

• 

  WB analysis of human heart using 66234-1-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66234-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig heart using 66234-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 66234-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66234-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66234-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66234-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 66234-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 66234-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66234-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using p38 MAPK antibody (66234-1-Ig, Clone: 1A1C2 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• Featured Product
• KD/KO Validated

p38 MAPK Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66234-1-Ig

Clone No.1A1C2

Publications(86)

Reviews (1)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

MAPK14, CSPB1, CSBP2, CSBP1, CSBP

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, HEK-293 cells, pig heart tissue, human heart tissue, K-562 cells, HSC-T6 cells, RAW 264.7 cells, MCF-7 cells
• Positive IHC detected in: human lung cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 83 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• CoIP: See 1 publications below

Product Information

66234-1-Ig targets p38 MAPK in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5797

  Product name: Recombinant human p38 MAPK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-307 aa of BC031574

  Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

• Full Name: mitogen-activated protein kinase 14
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC031574
• Gene Symbol: p38 MAPK
• Gene ID (NCBI): 1432
• RRID: AB_2861335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Hazard Mater; ERK/p38/ROS burst responses to environmentally relevant concentrations of diphenyl phosphate-evoked neutrophil extracellular traps formation: Assessing the role of autophagy.; Authors - Siwen Li
mouse	WB	Free Radic Biol Med; Cathelicidin-WA attenuates LPS-induced inflammation and redox imbalance through activation of AMPK signaling.; Authors - Weiche Wu
human	WB	J Invest Dermatol; GRP78 Downregulation in Keratinocytes Promotes Skin Inflammation Via the Recruitment and Activation of CCR6+ IL-17A-producing γδ T Cells; Authors - Liang Zhao
human	WB	Pharmacol Res; CX-5461 is a potent immunosuppressant which inhibits T cell-mediated alloimmunity via p53-DUSP5.; Authors - Guopin Pan
human	WB	Pharmacol Res; Anti-thrombotic effects mediated by dihydromyricetin involve both platelet inhibition and endothelial protection.; Authors - Shuai Chen
	WB	Development; FOXO1 mediates hypoxia-induced G0/G1 arrest in ovarian somatic granulosa cells by activating the TP53INP1-p53-CDKN1A pathway.; Authors - Chengyu Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Karen (Verified Customer) (11-10-2022)

p38MAPK detection for WB is not good, no bands detectable with different dilutions (1:500 and 1:1000). The same membrane was incubated with another p38MAPK antibody and was nicely visible.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000 and 1:500
• Cell Tissue Type: HaCaTs

p38 MAPK Antibody Western Blot validation (1:1000 and 1:500 dilution) in HaCaTs (Cat no:66234-1-Ig)