p38 MAPK Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HEK-293 using 66234-1-Ig (same clone as 66234-1-PBS)

  WB result of p38 MAPK antibody (66234-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-p38 MAPK transfected HEK-293 cells. This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66234-1-Ig (same clone as 66234-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 66234-1-Ig (same clone as 66234-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66234-1-Ig (same clone as 66234-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 66234-1-Ig (same clone as 66234-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66234-1-Ig (p38 MAPK Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66234-1-Ig (p38 MAPK antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66234-1-Ig (same clone as 66234-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using p38 MAPK antibody (66234-1-Ig, Clone: 1A1C2 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66234-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50419-1

  Cytometric bead array standard curve of MP50419-1, p38 MAPK Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66234-1-PBS. Detection antibody: 68965-1-PBS. Standard:Ag5797. Range: 0.195-200 ng/mL.

• 

  Cytometric bead array standard curve of MP50419-2

  Cytometric bead array standard curve of MP50419-2, p38 MAPK Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66234-1-PBS. Detection antibody: 68966-1-PBS. Standard:Ag5797. Range: 1.563-200 ng/mL.

• Featured Product
• KD/KO Validated

p38 MAPK Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 66234-1-PBS

Clone No.1A1C2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

MAPK14, CSPB1, CSBP2, CSBP1, CSBP

---

Product Information

66234-1-PBS targets p38 MAPK as part of a matched antibody pair:

MP50419-1: 66234-1-PBS capture and 68965-1-PBS detection (validated in Cytometric bead array)

MP50419-2: 66234-1-PBS capture and 68966-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5797

  Product name: Recombinant human p38 MAPK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-307 aa of BC031574

  Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

• Full Name: mitogen-activated protein kinase 14
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC031574
• Gene Symbol: p38 MAPK
• Gene ID (NCBI): 1432
• RRID: AB_2861335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16539
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.