CoraLite® Plus 488-conjugated p38 MAPK Recombinant monoclonal antibody

p38 MAPK Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-80821-2
Clone No.230263D11

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IF/ICC

CSAID binding protein, CSBP, CSBP1, CSBP2, CSPB1, EXIP, MAP kinase 14, MAP kinase MXI2, MAP kinase p38 alpha, MAPK 14, MAPK14, MAX interacting protein 2, Mxi2, p38, p38ALPHA, PRKM14, PRKM15, RK, SAPK2A

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80821-2 targets p38 MAPK in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5115

Product name: Recombinant human p38 MAPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-307 aa of BC031574

Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

Predict reactive species
Full Name mitogen-activated protein kinase 14
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight38-42 kDa
GenBank Accession NumberBC031574
Gene Symbol p38 MAPK
Gene ID (NCBI) 1432
RRIDAB_3673040
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16539
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 p38 MAPK antibody CL488-80821-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...