• Featured Product
  • KD/KO Validated

p38 MAPK Recombinant monoclonal antibody

p38 MAPK Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 80821-2-RR
Clone No.230263D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

MAPK14, 230263D11, CSAID-binding protein, CSBP, CSBP1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HepG2 cells, HeLa cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, RAW 264.7 cells, PC-12 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

80821-2-RR targets p38 MAPK in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5115

Product name: Recombinant human p38 MAPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-307 aa of BC031574

Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

Predict reactive species
Full Name mitogen-activated protein kinase 14
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight38-42 kDa
GenBank Accession NumberBC031574
Gene Symbol p38 MAPK
Gene ID (NCBI) 1432
RRIDAB_3670489
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16539
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for p38 MAPK antibody 80821-2-RRDownload protocol
IHC protocol for p38 MAPK antibody 80821-2-RRDownload protocol
IF protocol for p38 MAPK antibody 80821-2-RRDownload protocol
IP protocol for p38 MAPK antibody 80821-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Eur J Pharmacol

Study of the ameliorative effect of β-Bisabolene on ischemic stroke via COX-2 with the Keap1/Nrf2 and MAPK pathways

Authors - Xingfang Zhang
Loading...