AMACR/p504S Monoclonal antibody, PBS Only

AMACR/p504S Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 60240-1-PBS
Clone No.2H9B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

AMACR, p504S, EC:5.1.99.4, Alpha-methylacyl-CoA racemase, 2-methylacyl-CoA racemase

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60240-1-PBS targets AMACR/p504S in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8720

Product name: Recombinant human p504S,AMACR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-135 aa of BC009471

Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS

Predict reactive species
Full Name alpha-methylacyl-CoA racemase
Calculated Molecular Weight 382 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC009471
Gene Symbol AMACR
Gene ID (NCBI) 23600
RRIDAB_2881363
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UHK6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing. Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4).

Loading...
||
New chat Able
正在加载,请稍候...