AMACR/p504S Monoclonal antibody, PBS Only

• 

  WB analysis using 60240-1-Ig (same clone as 60240-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60240-1-Ig (p504S,AMACR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 60240-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 60240-1-Ig (same clone as 60240-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60240-1-Ig (p504S,AMACR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 60240-1-Ig (same clone as 60240-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60240-1-Ig (p504S,AMACR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60240-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 60240-1-Ig (same clone as 60240-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using p504S,AMACR antibody (60240-1-Ig, Clone: 2H9B5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 60240-1-PBS in a different storage buffer formulation.

AMACR/p504S Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 60240-1-PBS

Clone No.2H9B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

AMACR, p504S, EC:5.1.99.4, Alpha-methylacyl-CoA racemase, 2-methylacyl-CoA racemase

---

Product Information

60240-1-PBS targets AMACR/p504S in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8720

  Product name: Recombinant human p504S,AMACR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC009471

  Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS

• Full Name: alpha-methylacyl-CoA racemase
• Calculated Molecular Weight: 382 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC009471
• Gene Symbol: AMACR
• Gene ID (NCBI): 23600
• RRID: AB_2881363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UHK6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing. Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4).