Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human colon tissue, human liver cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, TNF alpha treated HT-1080 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10745-1-AP targets NF-κB p65 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, canine, chicken, bovine, hamster, goat, fish, bombyx mori, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species |
| Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
| Calculated Molecular Weight | 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC011603 |
| Gene Symbol | NF-κB p65 |
| Gene ID (NCBI) | 5970 |
| RRID | AB_2178878 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q04206 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RELA.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| IHC protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| IP protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| WB protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
NF-κB p65 Polyclonal antibody (Cat# 10745-1-AP) has accumulated 2,388 citations in journals including Nature Communications, Nature Immunology, Nature Microbiology, Science Advances, Cell Metabolism, Cancer Cell, Molecular Cell, Blood, Autophagy, Journal of Hematology & Oncology, Theranostics, Biomaterials, Advanced Science, and ACS Nano. Associated research fields include oncology, immunology and inflammation, metabolic disease, neurology, infectious disease, cardiovascular disease, bone and joint disorders, and nanomedicine-based therapeutics.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Identification of glutamine as a potential therapeutic target in dry eye disease | ||
Signal Transduct Target Ther Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma. | ||
Cancer Cell Overcoming tyrosine kinase inhibitor resistance in lung cancer brain metastasis with CTLA4 blockade | ||
J Hematol Oncol Exosomes released by hepatocarcinoma cells endow adipocytes with tumor-promoting properties. | ||
J Hematol Oncol Lung tumor exosomes induce a pro-inflammatory phenotype in mesenchymal stem cells via NFκB-TLR signaling pathway. | ||
J Hematol Oncol Tumor stem-like cell-derived exosomal RNAs prime neutrophils for facilitating tumorigenesis of colon cancer. |
Reviews
What customers say
Users overwhelmingly rate this antibody positively (9/10 five-star). It performs well across Western Blot, IHC, IF, and cell culture applications, with typical dilutions of 1:200–1:2000. Reviewers highlight strong specific signals in human cell lines (THP-1, K562, NSC-34, HeLa) and tissues (spinal cord, pharyngeal mucosa). One user noted some unspecific binding in human breast cancer cell lines and lack of reactivity in mouse cells. Overall, it is described as reliable and easy to work with.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Karthick (Verified Customer) (04-08-2026) | 1 in 1000 dilution, NFKB antibody works well
 |
Mounika (Verified Customer) (03-24-2026) | Very nice antibody, good to work with it1
|
Vignesh (Verified Customer) (11-18-2025) |
|
Maximilian (Verified Customer) (06-30-2023) | Quite a bit of unspecific binding. Did not work in mouse cell lines.
|
Xie (Verified Customer) (09-29-2022) | NF-κB p65 Antibody staining.
 |
Murali (Verified Customer) (01-24-2022) | Very nice antibody for IHC
 |
Azita (Verified Customer) (05-31-2021) | NSC-34 cells (motor neuron-like cells) strong labelling in WB
|
Zehua (Verified Customer) (12-17-2019) | After siRNA treatment for 48 hours, specific signal shown here. Works excellent!
 |
Feng-qian (Verified Customer) (12-07-2018) |
|
Fraser (Verified Customer) (06-06-2018) |
|
