• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated NF-κB p65 Polyclonal antibody

NF-κB p65 Polyclonal Antibody for IF/ICC
Cat No. CL594-10745

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

NF κB, p65, p65; RELA, RELA, NF Kappa B

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells, TNF alpha treated HT-1080 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 2 publications below

Product Information

CL594-10745 targets NF-κB p65 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1199

Product name: Recombinant human p65; RELA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-220 aa of BC011603

Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ

Predict reactive species
Full Name v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Calculated Molecular Weight 65 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC011603
Gene Symbol NF-κB p65
Gene ID (NCBI) 5970
RRIDAB_2919744
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ04206
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RELA.

Protocols

Product Specific Protocols
IF protocol for CL594 NF-κB p65 antibody CL594-10745Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Front Med (Lausanne)

New, potent, small molecule agonists of tyrosine kinase receptors attenuate dry eye disease

Authors - Zhiyuan Yu
mouseIF

Invest Ophthalmol Vis Sci

Induction of Innate Inflammatory Pathways in the Corneal Epithelium in the Desiccating Stress Dry Eye Model

Authors - Zhiyuan Yu
Loading...
||
New chat Able
正在加载,请稍候...