4EBP1 Fusion Protein

Source

E. coli-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

1

Cat no : Ag5056

Synonyms

4E-BP1; 4EBP1; BP-1; MGC4316; PHAS-I



Product Information

Peptide Sequence MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
(1-118 aa encoded by BC004459)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.

Publications

SpeciesTitle

Cell Death Dis

Iron-dependent CDK1 activity promotes lung carcinogenesis via activation of the GP130/STAT3 signaling pathway.

Authors - Yanbin Kuang