Product Information
83018-1-RR targets ABCA3 in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag24749 Product name: Recombinant human ABCA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1606-1704 aa of BC140895 Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR Predict reactive species |
Full Name | ATP-binding cassette, sub-family A (ABC1), member 3 |
GenBank Accession Number | BC140895 |
Gene Symbol | ABCA3 |
Gene ID (NCBI) | 21 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q99758 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABCA3 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCA3, which is expressed in alveolar type II pneumocytes and localizes predominantly to the limiting membrane of lamellar bodies, is critical for synthesis of surfactant(PMID: 17267394). Mutation of the ABCA3 gene causes fatal surfactant deficiency in newborns(PMID: 15044640).