Use Able AI chat for product recommendations

Perilipin-2 Monoclonal antibody

Perilipin-2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60340-1-Ig
Clone No. 1G5D4
Publications (9)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

ADRP/Perilipin-2, 1G5D4, ADFP, Adipophilin, Adipose differentiation-related protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Perilipin-2 in ?

Tested Applications

Positive WB detected inhuman adipose tissue
Positive IHC detected inhuman renal cell carcinoma tissue, mouse brown adipose tissue, rat brown adipose tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60340-1-Ig targets Perilipin-2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7643

Product name: Recombinant human ADRP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 88-437 aa of BC005127

Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH

Predict reactive species
Full Name adipose differentiation-related protein
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 47-52 kDa
GenBank Accession NumberBC005127
Gene Symbol Perilipin-2
Gene ID (NCBI) 123
RRIDAB_2881449
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99541
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases.

Protocols

Product Specific Protocols
IHC protocol for Perilipin-2 antibody 60340-1-IgDownload protocol
WB protocol for Perilipin-2 antibody 60340-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Perilipin-2 (ADRP) Monoclonal antibody (1G5D4), catalog number 60340-1-Ig, has 9 citations. These appear in journals including Cell Metabolism, MedComm, Phytomedicine, ACS Applied Materials & Interfaces, NPJ Regenerative Medicine, Virulence, Life Sciences, Brain Research, and Biochemical and Biophysical Research Communications. Research fields span lipid droplet biology, autoimmune inflammation, ferroptosis, angiogenesis, wound healing, viral propagation, diabetic kidney disease, neuroinflammation, and skeletal muscle lipid metabolism.

SpeciesApplicationTitle
humanWB

Cell Metab

Lipid droplet-induced T cell death sustains autoimmune tissue inflammation

Authors - Jitendra Kumar

MedComm (2020)

Loss of Rab8a-Dependent Tethering of Lipid Droplets to Mitochondria Contributes to Hypoxia-Reoxygenation Injury.

Authors - Jialing Tang

Phytomedicine

Curculigoside A alleviates metabolic dysfunction-associated steatohepatitis by targeting Rab30 to improve lipid homeostasis.

Authors - Yue Shi
human,mouse,ratWB

ACS Appl Mater Interfaces

Nanovesicles Synergistically Regulate Ferroptosis Characteristic Macrophage-Induced Angiogenesis via Ferritin Heavy Chain 1/Glutathione Peroxidase 4 Pathway to Promote Peripheral Nerve Regeneration.

Authors - Nianci Huo

NPJ Regen Med

Gli2-serpinh1 drives fibroblast state transition during skin wound healing.

Authors - Rui Ma
pigWB

Virulence

PLIN3-triggered lipophagic flux releases FFAs to facilitate CSFV propagation.

Authors - Bingke Li
Loading...
||
New chat

Able™

正在加载,请稍候...