Perilipin-2 Monoclonal antibody, PBS Only

Perilipin-2 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 60340-1-PBS
Clone No.1G5D4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

ADRP/Perilipin-2, 1G5D4, ADFP, Adipophilin, Adipose differentiation-related protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60340-1-PBS targets Perilipin-2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7643

Product name: Recombinant human ADRP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 88-437 aa of BC005127

Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH

Predict reactive species
Full Name adipose differentiation-related protein
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 47-52 kDa
GenBank Accession NumberBC005127
Gene Symbol Perilipin-2
Gene ID (NCBI) 123
RRIDAB_2881449
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99541
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases.

Loading...
||
New chat Able
正在加载,请稍候...