AGFG1 Fusion Protein

Catalog number: Ag3352
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

AGFG1 fusion protein Ag3352 SDS-PAGE


Product Name:
human AGFG1-GST fusion protein

Catalog No:
Ag3352

Source:
E. coli-derived, PKG

Peptide Sequence:
SAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQ
(4-303aa encoded by BC030592)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top