Tested Applications
| Positive WB detected in | COLO 320 cells, HepG2 cells, HSC-T6 cells, HEK-293 cells, MCF-7 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29445-1-AP targets ATG16L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31318 Product name: Recombinant human ATG16L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC000061 Sequence: NKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLS Predict reactive species |
| Full Name | ATG16 autophagy related 16-like 1 (S. cerevisiae) |
| Calculated Molecular Weight | 607 aa, 68 kDa |
| Observed Molecular Weight | 68-75 kDa |
| GenBank Accession Number | BC000061 |
| Gene Symbol | ATG16L1 |
| Gene ID (NCBI) | 55054 |
| RRID | AB_2918308 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q676U5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 66 kDa; and Atg16L1β, 68 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATG16L1 antibody 29445-1-AP | Download protocol |
| IHC protocol for ATG16L1 antibody 29445-1-AP | Download protocol |
| WB protocol for ATG16L1 antibody 29445-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ATG16L1 Polyclonal antibody (Cat# 29445-1-AP) has 12 citations published in journals including Nature Cell Biology, Autophagy, Cancer Letters, Cell Signaling, Journal of Nanobiotechnology, Food & Function, Journal of Cellular and Molecular Medicine, Schizophrenia Research, FEBS Letters, and Anticancer Drugs. Research fields span autophagy regulation, ribophagy, lysosome clearance, cancer (breast, ovarian, laryngeal), Alzheimer's disease, osteoarthritis, colitis, liver ischemia-reperfusion injury, and schizophrenia.
| Species | Application | Title |
|---|---|---|
Autophagy Regulation of N-Degron Recognin-Mediated Autophagy by the sars-cov-2 plpro ubiquitin deconjugase | ||
Autophagy The ER protein CANX (calnexin)-mediated autophagy protects against alzheimer disease | ||
J Nanobiotechnology Engineering exosomes derived from TNF-α preconditioned IPFP-MSCs enhance both yield and therapeutic efficacy for osteoarthritis | ||
Cancer Lett LncRNA HITT inhibits autophagy by attenuating ATG12-ATG5-ATG16L1 complex formation | ||
Food Funct EPA and DHA differentially coordinate the crosstalk between host and gut microbiota and block DSS-induced colitis in mice by a reinforced colonic mucus barrier. |
Reviews
What customers say
One reviewer (3/5 stars) tested this antibody by Western Blot at 1/500 dilution. Using 25 µg of gastrocnemius muscle total protein from mdx mice (a Duchenne muscular dystrophy model), they observed a strong full-length band along with multiple lower molecular weight bands. However, 25 µg of total protein from pooled wild-type zebrafish at 5 days post-fertilization produced no detectable bands. Overall, the antibody showed good performance in mouse muscle tissue but failed to detect target in zebrafish lysate under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boel (Verified Customer) (07-30-2025) | 25µg gastrocnemius muscle total protein extract from mdx mouse (dystrophin deficient mice that are used as a model for Duchenne muscular dystrophy) generated a strong band of full lenght protein plus multiple additional bands of lower molecular weight. 25µg of total protein extract from pooled wild type zebrafish 5 days post fertilization generated no protein bands.
 |
