ATXN2L Fusion Protein

Catalog number: Ag20581

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

ATXN2L fusion protein Ag20581 SDS-PAGE


Product Name:
human ATXN2L-GST fusion protein

Catalog No:
Ag20581

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
SYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNMAHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRILQSHPSQQLPFHPPGN
(99468 encoded by BC082760)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top