BAX Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

4

Cat no : Ag0576

Synonyms

BCL2L4



Product Information

Peptide Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
(1-192 aa encoded by BC014175)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.

Publications

SpeciesTitle

Nanoscale Res Lett

Cytotoxicity induced by nanobacteria and nanohydroxyapatites in human choriocarcinoma cells.

Authors - Mingjun Zhang

EBioMedicine

OCIAD1 contributes to neurodegeneration in Alzheimer's disease by inducing mitochondria dysfunction, neuronal vulnerability and synaptic damages.

Authors - Xuping Li
human

Cell Death Dis

DRAM1 regulates apoptosis through increasing protein levels and lysosomal localization of BAX.

Authors - J-J Guan

Clin Cancer Res

Effect of a Smac Mimetic (TL32711, Birinapant) on the Apoptotic Program and Apoptosis Biomarkers Examined with Validated Multiplex Immunoassays Fit for Clinical Use.

Authors - Apurva K Srivastava