BCL2L2 Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Powder

Cat no : Ag8863

Synonyms

BCL-W; BCLW; KIAA0271



Product Information

Peptide Sequence MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
(1-171 aa encoded by BC021198)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Purity85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.