Tested Applications
| Positive WB detected in | C2C12 cells, HEK-293 cells, HCT 116 cells, HeLa cells, K-562 cells, NIH/3T3 cells, PC-12 cells, RAW 264.7 cells |
| Positive IHC detected in | human tonsillitis tissue, human breast cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24474-1-AP targets C1QBP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19773 Product name: Recombinant human C1QBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC013731 Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ Predict reactive species |
| Full Name | complement component 1, q subcomponent binding protein |
| Calculated Molecular Weight | 282 aa, 31 kDa |
| Observed Molecular Weight | 32-35 kDa |
| GenBank Accession Number | BC013731 |
| Gene Symbol | C1QBP |
| Gene ID (NCBI) | 708 |
| RRID | AB_2827427 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07021 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C1QBP antibody 24474-1-AP | Download protocol |
| IHC protocol for C1QBP antibody 24474-1-AP | Download protocol |
| WB protocol for C1QBP antibody 24474-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-C1QBP (p32) antibody (Cat# 24474-1-AP) has 19 citations across journals including Blood, PNAS, Oncogene, Biomaterials, Advanced Science, Journal of Controlled Release, Free Radical Biology and Medicine, Frontiers in Immunology, Cell Regeneration, PLoS Pathogens, and others. Research fields span oncology (leukemia, gastric cancer, brain metastasis), neurodegeneration (Parkinson's disease), immunology (T cell function, macrophage biology), infectious disease (viral pathogenesis), metabolic disorders (obesity, nephropathy), and cell biology (mitophagy, muscle differentiation).
| Species | Application | Title |
|---|---|---|
Blood C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse
| ||
Adv Sci (Weinh) HIGD1A Alleviates Oxidative Stress Related Ovarian Hypofunction by Enhancing Granulosa Cell Functions via NF-κB/SOD2 Signaling Pathway | ||
Biomaterials Ultrasound molecular imaging of p32 protein translocation for evaluation of tumor metastasis | ||
J Control Release PSMA-targeted nanoparticles for specific penetration of blood-brain tumor barrier and combined therapy of brain metastases. | ||
Proc Natl Acad Sci U S A A nucleolar long "non-coding" RNA encodes a novel protein that functions in response to stress | ||
Oncogene C1QBP forms a positive feedback loop with the PAICS/FAK/C-MYC axis to promote cancer cell proliferation. |
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot. Annabel Minton (2025) reported a clean single band at 1:1000 dilution on human and mouse B cell lysates, imaged with a blotting accelerator. Lana Yablonska (2019) used it at 1:500 dilution overnight at 4°C on HEK293t mitochondrial fractions, with an IRDye 800CW secondary antibody, and provided detailed protocol conditions including gel, transfer, and blocking parameters. Overall, users find this antibody reliable for WB with clear, specific results across different cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Annabel (Verified Customer) (12-23-2025) | Produces a single band by western blot, imaged using blotting accelerator.
 |
Lana (Verified Customer) (08-13-2019) | SDS-PAGE: 15 ug/ul RIPA lysate of the mitochondrial fraction of HEK293t. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h.Primary Ab: O/N incubation at 4C.Secondary Ab: IRDye 800CW Goat anti-Rabbit.
 |
