CoraLite® Plus 647-conjugated C1QBP Polyclonal antibody

• 

  FC experiment of HeLa using CL647-24474

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human C1QBP (CL647-24474) (red), or 0.2 ug Control Antibody (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

C1QBP Polyclonal Antibody for FC (Intra)

Cat No. CL647-24474

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

gC1Q R, ASF/SF2-associated protein p32, Complement component 1 Q subcomponent-binding protein, mitochondrial, GC1q R protein, GC1QBP

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-24474 targets C1QBP in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19773

  Product name: Recombinant human C1QBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-282 aa of BC013731

  Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

• Full Name: complement component 1, q subcomponent binding protein
• Calculated Molecular Weight: 282 aa, 31 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC013731
• Gene Symbol: C1QBP
• Gene ID (NCBI): 708
• RRID: AB_2934956
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07021
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

C1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).