Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells | 
| Positive IP detected in | A549 cells | 
| Positive IHC detected in | human breast cancer tissue, human lung tissue,  human heart tissue,  human liver tissue,  human lung cancer tissue,  mouse brain tissue,  mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 14 publications below | 
| WB | See 88 publications below | 
| IHC | See 18 publications below | 
| IF | See 25 publications below | 
| IP | See 4 publications below | 
| CoIP | See 2 publications below | 
Product Information
16447-1-AP targets Caveolin-1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, canine, monkey, zebrafish, bovine | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species | 
                                    
| Full Name | caveolin 1, caveolae protein, 22kDa | 
| Calculated Molecular Weight | 22 kDa | 
| Observed Molecular Weight | 20-25 kDa | 
| GenBank Accession Number | BC006432 | 
| Gene Symbol | CAV1 | 
| Gene ID (NCBI) | 857 | 
| RRID | AB_10732595 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q03135 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Caveolin-1 antibody 16447-1-AP | Download protocol | 
| IP protocol for Caveolin-1 antibody 16447-1-AP | Download protocol | 
| WB protocol for Caveolin-1 antibody 16447-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nucleic Acids Res Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis. | ||
Dev Cell Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells. | ||
Redox Biol Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis | ||
Biomaterials Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells. | ||
Small Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway. | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sammy (Verified Customer) (01-20-2024)  | Excellent antibody for use by western blotting. Diluted in 3% BSA PBST. 
 ![]()  | 
FH Priya (Verified Customer) (06-21-2023)  | Used this antibody for Caco2 cells andmice tissue 
  | 
FH Priya (Verified Customer) (06-21-2023)  | Used this antibody for Caco2 cells andmice tissue 
  | 
FH Priya (Verified Customer) (04-17-2023)  | Used for Caco2 cells 
  | 
FH Priya (Verified Customer) (04-17-2023)  | Used for Caco2 cells 
  | 
FH Emma (Verified Customer) (03-15-2022)  | Works really well @ 1:1000 for WB in PC3 and DU145 cells. Single band seen. 
  | 
FH Kushal (Verified Customer) (08-09-2021)  | We tried to use the antibody at high concentrations of 1:100, yet we do not get bands in our blots. 
  | 
































