Product Information
86007-2-RR targets CCL27 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2461 Product name: Recombinant Human CCL27 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 25-112 aa of NM_006664 Sequence: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 27 |
| Calculated Molecular Weight | 13kd |
| GenBank Accession Number | NM_006664 |
| Gene Symbol | CCL27 |
| Gene ID (NCBI) | 10850 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y4X3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
