cyclin C Polyclonal antibody

cyclin C Polyclonal Antibody for ELISA
Cat No. 14510-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

CCNC, CycC, cyclin C, hSRB11, SRB11 homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14510-1-AP targets cyclin C in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5969

Product name: Recombinant human CCNC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-283 aa of BC056153

Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

Predict reactive species
Full Name cyclin C
Calculated Molecular Weight 33 kDa
GenBank Accession NumberBC056153
Gene Symbol Cyclin C
Gene ID (NCBI) 892
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP24863
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.
Loading...
||
New chat Able
正在加载,请稍候...