Filter:
Tested Applications
| Positive WB detected in | HepG2 cells, human adrenal gland tissue, PC-12 cells, pig adrenal gland tissue |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67421-1-Ig targets CYP21A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species |
| Full Name | cytochrome P450, family 21, subfamily A, polypeptide 2 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 53-56 kDa |
| GenBank Accession Number | NM_000500 |
| Gene Symbol | CYP21A2 |
| Gene ID (NCBI) | 1589 |
| RRID | AB_2882661 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08686 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CYP21A2 antibody 67421-1-Ig | Download protocol |
| WB protocol for CYP21A2 antibody 67421-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
