Home
Products
Primary Antibodies
CYP21A2 Monoclonal antibody, PBS Only (67421-1-PBS)

CYP21A2 Monoclonal antibody, PBS Only

Name: CYP21A2 Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 67421-1-PBS-100UG

CYP21A2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67421-1-PBS

Clone No. 1G2G6

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

1G2G6, CA21H, CAH1, CPS1, CYP21

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICC

WB analysis using 67421-1-Ig (same clone as 67421-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Various lysates were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
WB analysis of human adrenal gland using 67421-1-Ig (same clone as 67421-1-PBS)
human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of pig adrenal gland using 67421-1-Ig (same clone as 67421-1-PBS)
pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-12 using 67421-1-Ig (same clone as 67421-1-PBS)
PC-12 cells were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of pig adrenal gland using 67421-1-Ig (same clone as 67421-1-PBS)
pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of PC-12 using 67421-1-Ig (same clone as 67421-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using CYP21A2 antibody (67421-1-Ig, Clone: 1G2G6 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP21A2 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67421-1-PBS targets CYP21A2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity	human, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species
Full Name	cytochrome P450, family 21, subfamily A, polypeptide 2
Calculated Molecular Weight	56 kDa
Observed Molecular Weight	53-56 kDa
GenBank Accession Number	NM_000500
Gene Symbol	CYP21A2
Gene ID (NCBI)	1589
RRID	AB_2882661
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P08686
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.