CYP21A2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67421-1-Ig (same clone as 67421-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human adrenal gland using 67421-1-Ig (same clone as 67421-1-PBS)

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig adrenal gland using 67421-1-Ig (same clone as 67421-1-PBS)

  pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 67421-1-Ig (same clone as 67421-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig adrenal gland using 67421-1-Ig (same clone as 67421-1-PBS)

  pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-12 using 67421-1-Ig (same clone as 67421-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using CYP21A2 antibody (67421-1-Ig, Clone: 1G2G6 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67421-1-PBS in a different storage buffer formulation.

CYP21A2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67421-1-PBS

Clone No.1G2G6

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

1G2G6, CA21H, CAH1, CPS1, CYP21

---

Product Information

67421-1-PBS targets CYP21A2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26292

  Product name: Recombinant human CYP21A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-202 aa of NM_000500

  Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS

• Full Name: cytochrome P450, family 21, subfamily A, polypeptide 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 53-56 kDa
• GenBank Accession Number: NM_000500
• Gene Symbol: CYP21A2
• Gene ID (NCBI): 1589
• RRID: AB_2882661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08686
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.