Product Information
67421-1-PBS targets CYP21A2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species |
Full Name | cytochrome P450, family 21, subfamily A, polypeptide 2 |
Calculated Molecular Weight | 56 kDa |
Observed Molecular Weight | 53-56 kDa |
GenBank Accession Number | NM_000500 |
Gene Symbol | CYP21A2 |
Gene ID (NCBI) | 1589 |
RRID | AB_2882661 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P08686 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |