Tested Applications
| Positive WB detected in | mouse brain tissue, mouse spinal cord tissue, mouse heart tissue, rat heart tissue, rat brain tissue | 
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue,  human lung cancer tissue,  mouse brain tissue,  rat brain tissue,  rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 | 
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 8 publications below | 
| IF | See 2 publications below | 
Product Information
17400-1-AP targets FGF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, pig | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag11366 Product name: Recombinant human FGF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC032697 Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Predict reactive species | 
                                    
| Full Name | fibroblast growth factor 1 (acidic) | 
| Calculated Molecular Weight | 155 aa, 17 kDa | 
| Observed Molecular Weight | 17 kDa | 
| GenBank Accession Number | BC032697 | 
| Gene Symbol | FGF1 | 
| Gene ID (NCBI) | 2246 | 
| RRID | AB_2103758 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P05230 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FGF1 antibody 17400-1-AP | Download protocol | 
| IHC protocol for FGF1 antibody 17400-1-AP | Download protocol | 
| WB protocol for FGF1 antibody 17400-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Neuropharmacology Non-mitogenic fibroblast growth factor 1 protects against ischemic stroke by regulating microglia/macrophage polarization through Nrf2 and NF-κB pathways. | ||
Life Sci A derivant of ginsenoside CK and its inhibitory effect on hepatocellular carcinoma. | ||
Physiol Rep Sitagliptin therapy improves myocardial perfusion and arteriolar collateralization in chronically ischemic myocardium: A pilot study | ||
J Cereb Blood Flow Metab Saturated fatty acids stimulate cytokine production in tanycytes via the PP2Ac-dependent signaling pathway | ||
Adv Sci (Weinh) Hepatocyte-Derived FGF1 Alleviates Isoniazid and Rifampicin-Induced Liver Injury by Regulating HNF4α-Mediated Bile Acids Synthesis
  | ||
Acta Pharmacol Sin Madecassoside mitigates acute myocardial infarction injury by activating the PKCB/SPARC signaling pathway | 































