FGF3 Fusion Protein

Catalog number: Ag25361
  • Print page
  • Download PDF

Be the first to review this product


$199.00€99.00£99.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

FGF3 fusion protein Ag25361 SDS-PAGE


Product Name:
human FGF3-GST fusion protein

Catalog No:
Ag25361

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
QKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
(173 - 239 aa encoded by BC113739)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top