Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, U-87 MG cells, PANC-1 cells, Neuro-2a cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86249-1-RR targets FKBP1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0406 Product name: Recombinant human FKBP1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-108 aa of BC001925 Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Predict reactive species |
| Full Name | FK506 binding protein 1A, 12kDa |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC001925 |
| Gene Symbol | FKBP1A |
| Gene ID (NCBI) | 2280 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P62942 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FKBP1A antibody 86249-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





