FKBP1A Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86249-1-RR (same clone as 86249-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86249-1-RR (FKBP1A antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86249-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86249-1-RR (same clone as 86249-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86249-1-RR (FKBP1A antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86249-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02313-2

  The mean FKBP1A concentration was determined to be 26.2 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02313-2

  Sandwich ELISA standard curve of MP02313-2, Human FKBP1A Recombinant Matched Antibody Pair - PBS only. 86249-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0406. 86249-4-PBS was HRP conjugated as the detection antibody. Range: 31.3-2000 pg/mL.

• 

  Affinity and Kinetic Characterization of 86249-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86249-1-RR against Human FKBP1A were performed. The affinity constant is 0.899 nM.

FKBP1A Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86249-1-PBS

Clone No.250923G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

12 kDa FK506-binding protein, Calstabin-1, FK506-binding protein 1A, FKBP 1A, FKBP1

---

Product Information

86249-1-PBS targets FKBP1A as part of a matched antibody pair:

MP02313-2: 86249-1-PBS capture and 86249-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0406

  Product name: Recombinant human FKBP1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-108 aa of BC001925

  Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

• Full Name: FK506 binding protein 1A, 12kDa
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC001925
• Gene Symbol: FKBP1A
• Gene ID (NCBI): 2280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62942
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.