Filter:
Tested Applications
| Positive WB detected in | mouse testis tissue |
| Positive IP detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IF | See 2 publications below |
Product Information
20183-1-AP targets GABRB1 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14070 Product name: Recombinant human GABRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 330-440 aa of BC022449 Sequence: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRNRRRASQLKVKI Predict reactive species |
| Full Name | gamma-aminobutyric acid (GABA) A receptor, beta 1 |
| Calculated Molecular Weight | 474 aa, 54 kDa |
| Observed Molecular Weight | 50-54 kDa |
| GenBank Accession Number | BC022449 |
| Gene Symbol | GABRB1 |
| Gene ID (NCBI) | 2560 |
| RRID | AB_10638781 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18505 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for GABRB1 antibody 20183-1-AP | Download protocol |
| WB protocol for GABRB1 antibody 20183-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
iScience Increased NMDARs in neurons and glutamine synthetase in astrocytes underlying autistic-like behaviors of Gabrb1-/- mice
| ||
Food Funct Ginsenoside Rg5/Rk1 ameliorated sleep via regulating the GABAergic/serotoninergic signaling pathway in a rodent model. | ||
Reprod Fertil Dev Sperm gamma-aminobutyric acid type A receptor delta subunit (GABRD) and its interaction with purinergic P2X2 receptors in progesterone-induced acrosome reaction and male fertility. | ||
Mol Nutr Food Res As a Histone Deacetylase Inhibitor, γ-Aminobutyric Acid Upregulates GluR2 Expression: An In Vitro and In Vivo Study. |
