Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 4 publications below |
| ELISA | See 1 publications below |
Product Information
10249-1-AP targets GDI1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0288 Product name: Recombinant human GDI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC000317 Sequence: MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI Predict reactive species |
| Full Name | GDP dissociation inhibitor 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC000317 |
| Gene Symbol | GDI1 |
| Gene ID (NCBI) | 2664 |
| RRID | AB_2111520 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31150 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55kda protein in SDS-PAGE. (PMID: 7929030,PMID: 19570034) This antibody can bind both GDIs for the close sequences.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GDI1 antibody 10249-1-AP | Download protocol |
| IP protocol for GDI1 antibody 10249-1-AP | Download protocol |
| WB protocol for GDI1 antibody 10249-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO Rep Amino acid starvation-induced LDLR trafficking accelerates lipoprotein endocytosis and LDL clearance. | ||
Neurobiol Dis Disruption of Rab11 activity in a knock-in mouse model of Huntington's disease. | ||
Proteomics 2-D DIGE analysis implicates cytoskeletal abnormalities in psychiatric disease. | ||















