Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, MCF-7 cells, HepG2 cells, mouse brain tissue, rat brain tissue, THP-1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue, human stomach tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 58 publications below |
| IHC | See 5 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
19662-1-AP targets Hexokinase 1 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8015 Product name: Recombinant human HK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 583-917 aa of BC008730 Sequence: SDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS Predict reactive species |
| Full Name | hexokinase 1 |
| Calculated Molecular Weight | 102 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC008730 |
| Gene Symbol | Hexokinase 1 |
| Gene ID (NCBI) | 3098 |
| RRID | AB_10859778 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19367 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The hexokinases (HKs) catalyze the first obligatory step in glucose metabolism to generate glucose-6-phosphate. This not only furthers glucose entry by maintaining the concentration gradient for facilitated glucose influx but also provides the first intermediate for essentially all major pathways using glucose. There are four conventional HK isoforms, HK1/2/3/4, encoded by four different genes. Most adult tissues express only HK1. Muscle and adipose tissue use HK2 for glycolysis, liver, and pancreatic beta cells express HK4 (also called glucokinase) and do not express HK1 or HK2. (PMID: 31434645, PMID: 31848318)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Hexokinase 1 antibody 19662-1-AP | Download protocol |
| IF protocol for Hexokinase 1 antibody 19662-1-AP | Download protocol |
| IHC protocol for Hexokinase 1 antibody 19662-1-AP | Download protocol |
| IP protocol for Hexokinase 1 antibody 19662-1-AP | Download protocol |
| WB protocol for Hexokinase 1 antibody 19662-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Dual impacts of serine/glycine-free diet in enhancing antitumor immunity and promoting evasion via PD-L1 lactylation | ||
Cell Stem Cell Generation of human alveolar epithelial type I cells from pluripotent stem cells | ||
Nat Immunol NF-κB-inducing kinase maintains T cell metabolic fitness in antitumor immunity. | ||
Nat Commun Cardiomyocyte OTUD1 drives diabetic cardiomyopathy via directly deubiquitinating AMPKα2 and inducing mitochondrial dysfunction | ||
Sci Adv Oligodendroglial glycolytic stress triggers inflammasome activation and neuropathology in Alzheimer's disease. | ||
Nat Commun SUMOylation controls the binding of hexokinase 2 to mitochondria and protects against prostate cancer tumorigenesis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Wei (Verified Customer) (01-30-2020) | Strong, clear band for mouse heart.
|
FH SCOTT (Verified Customer) (11-20-2018) | Used 1 in/1000 in 5% BSA TBS-Tween overnight at 4 C rolling. The membrane was blocked in 5% BSA TBS-Tween prior to adding the antibody.
|















