Use Able AI chat for product recommendations

HMGB1 Monoclonal antibody

HMGB1 Monoclonal Antibody for WB, ELISA

Cat No. 66525-1-Ig
Clone No. 1D12A6
Publications (65)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IP, CoIP, ELISA

1D12A6, high mobility group box 1, High mobility group protein 1, High mobility group protein B1, HMG 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for HMGB1 in ?

Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, L02 cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66525-1-Ig targets HMGB1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1264

Product name: Recombinant human HMGB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-215 aa of BC003378

Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Predict reactive species
Full Name high-mobility group box 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC003378
Gene Symbol HMGB1
Gene ID (NCBI) 3146
RRIDAB_2881888
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP09429
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The HMG (high mobility group) proteins are nonhistone chromosomal proteins that is present in almost all eukaryotic cells, and it functions to stabilize NUCLEOSOME formation and acts as a transcription-factor-like protein that regulates the expression of several genes[PMID: 18160415]. Once injury, infection or other inflammatory stimuli, activated macrophages, mature dendritic cells and natural killer cells can secret HMGB1, which act as a crucial cytokine[PMID: 20163887]. HMGB1 also involved in V(D)J recombination by acting as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS)[PMID: 19360789 ]. Act as a Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. HMGB1 (high mobility group box 1) modulates gene expression in the nucleus, but certain immune cells secrete HMGB1 as an extracellular Alarmin to signal tissue damage.The nuclear HMGB1 relocalizes to the extracellular milieu in senescent human and mouse cells in culture and in vivo, which stimulated cytokine secretion through TLR-4 signaling (23649808).This antibody is raised against full length HMGB1 of human origin. The monomeric HMGB1 is 29 kDa and dimer is 58 kDa.

Protocols

Product Specific Protocols
WB protocol for HMGB1 antibody 66525-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Anti-HMGB1 Mouse Monoclonal Antibody (cat. no. 66525-1-Ig) has 65 citations published across 57 journals, including Nature Communications, Nature Microbiology, Journal of Hepatology, Advanced Science, ACS Nano, Small, Cell Death & Disease, Biomaterials Research, and Journal of Controlled Release. Associated research fields encompass cancer immunotherapy, ferroptosis, pyroptosis, neuroinflammation, liver injury, radiation-induced tissue damage, wound healing, cardiovascular disease, and autophagy regulation.

SpeciesApplicationTitle
humanWB

J Hepatol

Nucleolin lactylation contributes to intrahepatic cholangiocarcinoma pathogenesis via RNA splicing regulation of MADD

Authors - Long Yang
mouse

Exploration (Beijing)

NIR II-Guided Photoactivatable Silencing Polyplex Boosts Cancer Immunotherapy.

Authors - Yuquan Zhang

Bioact Mater

NIR-II photo-accelerated polymer nanoparticles boost tumor immunotherapy via PD-L1 silencing and immunogenic cell death

Authors - Tian Zhang
mouseWB

Nat Commun

A protein-based cGAS-STING nanoagonist enhances T cell-mediated anti-tumor immune responses

Authors - Xuan Wang

ACS Nano

A First-Aid Nanomedicine Endowed with Microenvironment Self-Adaptive Regulation Ability to Facilitate Acute Liver Failure Prophylaxis and Therapy.

Authors - Jiale Zhang
mouse,humanWB

Redox Biol

Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma.

Authors - Zhongren Xu
Loading...
||
New chat

Able™

正在加载,请稍候...